7 Makanan Segar Sebagai Sumber Antioksi dan Alami

7 Makanan Segar Sebagai Sumber Antioksi dan Alami

Antioksidanmerupakansalahsatunutrisipenting yang dibutuhkanolehtubuh.Inidikarenakan, salahsatuperanutamaantioksidanyaitumencegahkerusakansel yang disebabkanolehradikalbebas yang dapatmasukketubuhseseorang.Radikalbebas yang bercampuroksigen yang kitahirupdapatmenjadipemicubeberapajeniskanker.Berbagaimakanansehatterbuktidapatmenangkalradikalbebas.Lalu, apasajamakanansehat yang memilikisumberantioksidan yang alamitersebut…???.

 

Sahabat, tips kesehatan.Udara yang bersihdanbebasdaripolusirasanyasudahsangatsulitdidapatkankhususnyadidaerahperkotaan.Inimungkindisebabkankurangmemadainyatamankota plus semakinbanyaknyasepeda motor danmobil yang menciptakanpolusimelaluiasap yang dikeluarkannya. Hal inilah yang menjadisalahsatupemicuudara yang kitahirupterkontaminasi (tercampur) berbagairadikalbebas.Nutrisiantioksidansangatdiperlukanuntukmelawanberbagairadikalbebas yang masuktubuh.Berikutini 7 makanansegarsebagaisumberantioksidanalami :

  1. Buah yang memilikicirifisikbulatdanbewarnamerahiniternyatasangatefektifuntuk  menangkalradikalbebas yang masukketubuh. Inidikarenakan, tomatmemilikikandungan lycopene yang cukuptinggi. Fungsi lycopene yang utamayaitusebagaizatantikanker.
  2. Salah satubumbudapurinimemilikikandungannutrisi yang terbilanglengkapseperti vitamin A, B, C, selenium, yodium, kalium, zatbesi, kalsium, sengserta magnesium. Berbagainutrisiinilah yang menjadikanbawangputihsebagaisumberantioksidanpenangkalradikalbebas.
  3. Sukaminumteh…???. Tehkhususnyatehhijauternyatajugasangatbagusuntukmenangkalradikalbebas. Inidikarenakan, tehhijaumengandungsumbercatechin polyphenol yang terbuktiefektifmencegahkanker. Sangatdisarankanuntukminum 3 (tiga) cangkirtehhijausetiaphari.
  4. Salah satusayuransumberantioksidan yang alamiadalahbrokoli. Sayuraninimengandungsulforaphane yang berfungsimemerangiberbagaijeniskanker yang dapatmengancamjiwaseseorang. Olehkarenaitulah, sangatdisarankanuntukmulaimenghidangkansayuranbrokolikedalammejamakananda.
  5. Buahstroberi…???. Ya, buahstroberiternyata  memilikiberbagaikandungannutrisiseperti protein, serat, kalsium, fosfor, vitamin C, folatserta vitamin A. Berbgainutrisiinilah yang menjadikanstroberisumberantioksidan yang dibutuhkanolehtubuhanda.
  6. Inilahsalahsatumakanankegemaran “Popeye”.  Faktanya, bayammemilikikandungannutrisisepertisumber vitamin A, vitamin K, mangan, folat, kalsium plus protein dan flavonoid. Nutrisi-nutrisiinilah yang bertindaksebagaiantioksidanpenangkalradikalbebas.
  7. Inilahsatumakanansehat yang juga di sukaiolehkelinci. Salah satukeunggulanwortelyaitusayuraninimemilikikandunganfalcarinol plus falcarindiol yang berfungsisebagainutrisiantikankerdanpenangkalradikalbebas. Jadi, makanansehat yang mana yang paling andasukaiuntukmemerangiradikalbebastersebut….???.

Semoga tips kesehatan yang mengulas 7 makanansegarsebagaisumberantioksidan yang alamidapatbermanfaatbagipembacasekalian. Akhir kata, salamhangatdaripenulis. Image courtesy of phasinphoto at FreeDigitalPhotos.net

 

Iklan